PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012569578.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GRAS
Protein Properties Length: 514aa    MW: 59896.7 Da    PI: 6.5747
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012569578.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS253.11e-771455122374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev.sPilkfsh 95 
                      + L+++Ae vs +++e+a++lL   + ++s +g+++qR++++f +AL +r+ +++ +  k    +e+se   +  l+  +l+ ++  P+ ++ +
  XP_012569578.1 145 SQFLFAAAEKVSFQQFERAKKLLFYCQWNSSATGNSVQRIVFHFSQALLERIEKETRRFTKGSLKNEESELLRKMDLNK-SLLCHIkIPFNQVMQ 238
                     678***************************************************7776666544444433223333333.33544438******* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     ++  qaI+e v  ++r+H iD+di+ G+Q +aL+qaL +R+      +++T+vg ++   k+++eetg++La+fAe+l++pf ++ ++++++ ++
  XP_012569578.1 239 FIGIQAIVEHVVYDTRIHLIDLDIKSGVQCIALMQALIERQdFMVEIFKVTAVGLNS--CKNKIEETGKNLASFAESLKLPFLYKCVLVEDMMEI 331
                     *****************************************445669********55..************************************ PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     +  +++++++Ea+aV + + l +l +++ ++e+    ++++++ ++P ++++ e ea+hns+sF++rf+eal +ysa+fd +e+ + +e++ r++
  XP_012569578.1 332 KEVDFEIEENEAVAVYSPYFLRSLISRQDCMEN----LMRVLRYIKPSIMIILEMEASHNSPSFVNRFMEALFFYSAFFDVVETCMKEEDDCRMM 422
                     *************************88888888....*************************************************999999999 PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      E+  l+  i+n+v +eg+er+ r+ +   Wr+ + +  + +  +se  + q +l+ +++  ++  +ve++ ++l+lgWk+ p+ s+SaWr
  XP_012569578.1 423 TEAI-LSAGIRNIVGAEGRERNVRNVKIDVWRRFFARYRMVESGFSEACVYQGELVAKEFVyGKFCNVEKNGKCLILGWKGTPMHSISAWR 512
                     9998.******************************************************9988989************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.992118491IPR005202Transcription factor GRAS
PfamPF035143.6E-75145512IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MFNDHQNQQQ EFEVGNFMLE EINFDPFHQP TQQFQETITT WPKNHNHKLS SIPTKPLQNN  60
ISLSSLEILR NHGTRFMKNI TNTKKTSLDN EQEKVSAEGI IRVAGTRYAQ KYSSHWNDGF  120
SIPTHPYGFD QWNFSEEENK DVELSQFLFA AAEKVSFQQF ERAKKLLFYC QWNSSATGNS  180
VQRIVFHFSQ ALLERIEKET RRFTKGSLKN EESELLRKMD LNKSLLCHIK IPFNQVMQFI  240
GIQAIVEHVV YDTRIHLIDL DIKSGVQCIA LMQALIERQD FMVEIFKVTA VGLNSCKNKI  300
EETGKNLASF AESLKLPFLY KCVLVEDMME IKEVDFEIEE NEAVAVYSPY FLRSLISRQD  360
CMENLMRVLR YIKPSIMIIL EMEASHNSPS FVNRFMEALF FYSAFFDVVE TCMKEEDDCR  420
MMTEAILSAG IRNIVGAEGR ERNVRNVKID VWRRFFARYR MVESGFSEAC VYQGELVAKE  480
FVYGKFCNVE KNGKCLILGW KGTPMHSISA WRFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-2617751236375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012569578.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLG7KSU20.0G7KSU2_MEDTR; GRAS family transcription factor
STRINGGLYMA19G40440.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.16e-48RGA-like 2